CJC-1295 without DAC
(Mod GRF 1-29)

|
2 mg vial Buy 1 to 4 $19.99 Each Buy 5 to 9 $17.99 Each Buy 10 or more $15.99 Each
|
| Sequence | Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 |
| Molecular Formula | C152H252N44O42 |
| One Letter Sequence | Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 |
| Physical Apperance | white powder |
| Form & Formulations | Sterile Filtered white lyophilized (freeze-dried) |
| Stability | 2 months at room temperature 24 months from date of receipt, 20 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, 20 to 70 °C under sterile conditions after reconstitution. |
| Suitability | suitable for cell culture and animal experiment |
| Purity | >98% by RP-HPLC |
| Storage | Store at -20°C. Product is guaranteed 2 years from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage. |
:
CJC-1295 is a tetrasubstituted 30-amino acid peptide hormone, primarily functioning as a growth hormone releasing hormone (GHRH) analog.
Clinical Research was first conducted for CJC-1295 during the mid-2000s. The objective of the peptide was to treat visceral fat deposits in obese AIDS patients, as increased levels of exogenous hgH are presumed to increase lipolysis (fat loss). The clinical research was ultimately successful for most research subjects
Another very positive benefit of CJC-1295 is its ability to promote slow wave sleep. Slow wave sleep is also known as deep sleep and is the portion of sleep responsible for the highest level of muscle growth and memory retention. SWS is decreased significantly in older adults and also with people who tend to exercise later in the evening. Clinical studies have shown that a once-daily administration of CJC-1295, a long-acting growth hormone-releasing hormone (GHRH) analog, normalizes growth in the GHRH can induce significantly deeper sleep in a mouse.Various experiments have been conducted to test the effectiveness of CJC-1295. The Journal of Clinical Endocrinology & Metabolism has reported dose-dependent increases in mean plasma GH concentrations by 2-10 fold for more than 6 days and increased IGF-1 concentrations 1.5-3 fold for 9-11 days. The mean half life was 5.8-8.1 days and after multiple doses mean IGF-1 levels remained above baseline for up to 28 days following. No serious adverse reactions were reported in any group participating in this research study. This peptide has the ability to stimulate growth hormone very significantly.
For Research Purpose only, Not for Human Consumption
