CJC-1295 With DAC


 

2 mg vial
Buy
1 to 4
$29.99 Each
Buy 5 to 9 $27.99 Each
Buy 10 or more $25.99 Each

Contact us for wholesale price

 

CJC-1295 DAC is an analog of GHRH 2MG

CJC-1295 DAC is a long-acting version of GHRH (Growth Hormone Releasing Hormone) which has had its half-life extended to 8 days. This is convenient as it means the product only needs peptide injection once or twice per week for continuously elevated levels of HGH and IGF-1. The advantage of using CJC-1295 DAC instead of actual GH injections is that injecting HGH 191 amino acid polypeptide hormone shuts down the natural production and therefore when injections cease, the ability to produce peptide hormones may be impaired requiring time to recover. Since CJC-1295 DAC stimulates the growth factor peptide release of production, this CJC1295 GHRH products on sale for research use only.

CJC-1295 has shown some amazing results as a growth hormone releasing hormone (GHRH) analog. Not only has CJC-1295 shown potential to increase growth hormone and IGF-I secretion and effects, but it has been able to do so in very large amounts. CJC - 1295 Stimulates GH and IGF-1 Secretion, and will keep a steady increase of growth hormone and IGF-1 with no increase in prolactin, leading to intense fat loss, and increases protein synthesis for more muscle growth.

For Research Purpose only, Not for Human Consumption

Sequence H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular Formula C152H252N44O42
One Letter Sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
Physical Apperance white powder
Form & Formulations Sterile Filtered white lyophilized (freeze-dried)
Stability 2 months at room temperature 24 months from date of receipt, ­20 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, ­20 to ­70 °C under sterile conditions after reconstitution.
Suitability suitable for cell culture and animal experiment
Purity >98% by RP-HPLC
Storage Store at -20°C. Product is guaranteed 2 years from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.