Sermorelin


 

2 mg vial
Buy 1 to 4 $15.99 Each
Buy 5 to 9 $13.99 Each
Buy 10 or more $11.99 Each

Contact us for wholesale price

 

Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Molecular Formula C149H246N44O42S
One Letter Sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2
Physical Apperance White Powder
Form & Formulations Sterile Filtered white lyophilized (freeze-dried)
Stability 2 months at room temperature 24 months from date of receipt, ­20 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, ­20 to ­70 °C under sterile conditions after reconstitution.
Suitability suitable for cell culture and animal experiment
Purity >98% by RP-HPLC
Storage Lyophilized SERMORELIN although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FST should be stored at 4°C between 2-7 days and for future use below -18°C.

 

Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29-amino acid polypeptide that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues. It is used as a test for growth hormone secretion and often used extensively in anti-aging therapy in conjunction with testosterone in men.

For Research Purpose only, Not for Human Consumption